Anti-CD5

Anti-CD5
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4028 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD5 is a member of the scavenger receptor... mehr
Produktinformationen "Anti-CD5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. Protein function: May act as a receptor in regulating T-cell proliferation. [The UniProt Consortium]
Schlagworte: Anti-CD5, Anti-LEU1, Anti-Lymphocyte antigen T1/Leu-1, Anti-T-cell surface glycoprotein CD5, CD5 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4028

Eigenschaften

Anwendung: WB, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH from the human protein
Format: Immune Reaction

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD5"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen