Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm

Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
NSJ-R31918 | 100 µg | - | - |
3 - 10 Werktage* |
772,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD45 (Cluster of Differentiation 45), also... mehr
Produktinformationen "Anti-CD45"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD45 (Cluster of Differentiation 45), also known as PTPRC, LCA or CD45R, is an enzyme that, in humans, is encoded by the PTPRC gene. It is a member of the protein tyrosine phosphatase (PTP) family. CD45 is a major high molecular mass leukocyte cell surface molecule which is also an integral membrane protein tyrosine phosphatase. The cytogenetic location of CD45 is 1q31.3-q32.1. This gene is especially a prototype for transmembrane protein-tyrosine phosphatase (PTP). Targeted disruption of the CD45 gene leads to enhanced cytokine and interferon receptor-mediated activation of JAKs and STAT proteins. In vitro, CD45 directly dephosphorylates and binds to JAKs. Functionally, CD45 negatively regulates interleukin-3-mediated cellular proliferation, erythropoietin-dependent hematopoiesis, and antiviral responses in vitro and in vivo. In addition, CD45 has been best studied in T cells, where it determines T cell receptor signaling thresholds. CD45 is moved into or out of the immunological synapse (IS) membrane microdomain depending on the relative influence of interaction with the extracellular galectin lattice or the intracellular actin cytoskeleton. Galectin interaction can be finetuned by varying usage of the heavily Oglycosylated spliced regions and sialylation of Nlinked carbohydrates. Protein function: Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity. [The UniProt Consortium]
Schlagworte: | Anti-L-CA, Anti-T200, Anti-CD45, Anti-PTPRC, EC=3.1.3.48, Anti-Leukocyte common antigen, Anti-Receptor-type tyrosine-protein phosphatase C, CD45 Antibody |
Hersteller: | NSJ Bioreagents |
Hersteller-Nr: | R31918 |
Eigenschaften
Anwendung: | WB, IHC (paraffin) |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
Immunogen: | Amino acids EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK of human CD45 were used as the immunogen for the CD45 antibody. |
Format: | Purified |
Datenbank Information
KEGG ID : | K06478 | Passende Produkte |
UniProt ID : | P08575 | Passende Produkte |
Gene ID : | GeneID 5788 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | -20°C (International: -20°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD45"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen