Anti-CD41

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41100.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen,... mehr
Produktinformationen "Anti-CD41"
Protein function: Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha- IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface. [The UniProt Consortium]
Schlagworte: Anti-GP2B, Anti-ITGA2B
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41100

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 677-711 of Human CD41. (EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN)
MW: 113 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD41"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen