Anti-CD19

Anti-CD19
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31973 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. B-lymphocyte antigen CD19, also known as... mehr
Produktinformationen "Anti-CD19"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. B-lymphocyte antigen CD19, also known as CD19 (Cluster of Differentiation 19), is a protein that in humans is encoded by the CD19 gene. It is found on the surface of B-cells, a type of white blood cell. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. The CD19 gene encodes a cell surface molecule that assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. Protein function: Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [The UniProt Consortium]
Schlagworte: Anti-CD19, Anti-B-lymphocyte antigen CD19, Anti-Differentiation antigen CD19, Anti-T-cell surface antigen Leu-12, Anti-B-lymphocyte surface antigen B4, CD19 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31973

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids LVGILHLQRALVLRRKRKRMTDPTRRFFKVT of human CD19 were used as the immunogen for the anti-CD19 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD19"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen