Anti-CD18

Anti-CD18
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R30292 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The beta-2 integrin chain gene is... mehr
Produktinformationen "Anti-CD18"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the ôinside-outö signaling pathways. Protein function: Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha- D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. [The UniProt Consortium]
Schlagworte: Anti-CD18, Anti-ITGB2, Anti-Integrin beta-2, Anti-Complement receptor C3 subunit beta, Anti-Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, CD18 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R30292

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: An amino acid sequence from the N-terminus of human CD18 (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) was used as the immunogen for this CD18 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CD18"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen