Anti-CCT3, clone 12H4

Anti-CCT3, clone 12H4
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4525 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-complex protein 1 subunit gamma is a... mehr
Produktinformationen "Anti-CCT3, clone 12H4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8. Protein function: Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis (PubMed:25467444). The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance (PubMed:25467444). As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia (PubMed:20080638). The TRiC complex plays a role in the folding of actin and tubulin (Probable). [The UniProt Consortium]
Schlagworte: Anti-CCT3, Anti-CCTG, Anti-hTRiC5, Anti-CCT-gamma, Anti-TCP-1-gamma, Anti-T-complex protein 1 subunit gamma, CCT3 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4525

Eigenschaften

Anwendung: WB
Antikörper-Typ: Monoclonal
Klon: 12H4
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CCT3, clone 12H4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen