Anti-CCKBR

Anti-CCKBR
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4324 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The cholecystokinin B receptor, also known... mehr
Produktinformationen "Anti-CCKBR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors. Protein function: Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. [The UniProt Consortium]
Schlagworte: Anti-CCKBR, Anti-CCKRB, Anti-CCK-BR, Anti-CCK2-R, Anti-CCK-B receptor, Anti-Cholecystokinin-2 receptor, Anti-Gastrin/cholecystokinin type B receptor, CCKBR Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4324

Eigenschaften

Anwendung: WB, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids PVYTVVQPVGPRVLQCVHRWPSARVRQTWS were used as the immunogen for the CCKBR antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CCKBR"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen