Anti-CCDC6

Anti-CCDC6
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32518 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Coiled-coil domain-containing protein 6 is... mehr
Produktinformationen "Anti-CCDC6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.
Schlagworte: Anti-CCDC6, Anti-D10S170, Anti-Protein H4, Anti-Coiled-coil domain-containing protein 6, Anti-Papillary thyroid carcinoma-encoded protein, CCDC6 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32518

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CCDC6"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen