Anti-Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, P

Anti-Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, P
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
124362.100 100 µg - -

5 - 10 Werktage*

850,00 €
 
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase)... mehr
Produktinformationen "Anti-Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, P"
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family and is a downstream effector cysteine protease in the apoptotic pathway. It is made of two subunits, p20 and p11, which form the active complex. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is related to mammalian interleukin-1 converting enzyme (ICE) and to its Caenorhabditis elegans homologue, CED-3. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. It is ubiquitously expressed in normal Human tissues including the liver, spleen, heart, liver and kidney. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 124362

Eigenschaften

Anwendung: ELISA
Antikörper-Typ: Monoclonal
Klon: 4D3
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, P"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen