Anti-C4BPB

Anti-C4BPB
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58374.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Controls the classical pathway of complement activation. It binds as a cofactor... mehr
Produktinformationen "Anti-C4BPB"
Protein function: Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. It also interacts with anticoagulant protein S and with serum amyloid P component. The beta chain binds protein S. [The UniProt Consortium]
Schlagworte: Anti-C4BPB, Anti-C4b-binding protein beta chain
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58374

Eigenschaften

Anwendung: IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: dog, swine)
Immunogen: Synthetic peptide around the N-terminal region of Human C4BPB. (within the following sequence: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV)
MW: 28 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-C4BPB"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen