Anti-Brain Natriuretic Peptide, aa1-32 (BNP)

Anti-Brain Natriuretic Peptide, aa1-32 (BNP)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
B2702-33B.10 10 µg - -

3 - 19 Werktage*

517,00 €
B2702-33B.100 100 µg - -

3 - 19 Werktage*

1.071,00 €
 
Human brain natriuretic peptide (BNP) is a secreted protein which is a member of the natriuretic... mehr
Produktinformationen "Anti-Brain Natriuretic Peptide, aa1-32 (BNP)"
Human brain natriuretic peptide (BNP) is a secreted protein which is a member of the natriuretic peptide family. BNP is a cardiac hormone, which is synthesized as a pro-hormone (proBNP), and is proteolytically cleaved to release a biologically active fragment (BNP), and an inactive fragment (NT-proBNP) into the circulation. , , BNP is predominantly secreted from the cardiac ventricles in response to volume and pressure overload, and results in a number of biological activities including natriuresis, diuresis, vasorelaxation, and inhibition of the sympathetic nervous system. A high concentration of BNP in the bloodstream is indicative of heart failure. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Anti-NPPB, Anti-BNP-32, Anti-BNP(3-29), Anti-BNP(5-29), Anti-BNP(3-32), Anti-BNP(4-31), Anti-BNP(1-30), Anti-BNP(1-29), Anti-BNP(3-30), Anti-BNP(2-31), Anti-BNP(1-28), Anti-BNP(5-32), Anti-BNP(5-31), Anti-BNP(4-29), Anti-BNP(4-30), Anti-BNP(1-32)
Hersteller: United States Biological
Hersteller-Nr: B2702-33B

Eigenschaften

Anwendung: ELISA
Antikörper-Typ: Monoclonal
Klon: 7-13
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Brain Natriuretic Peptide, aa1-32 (BNP)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen