Anti-BMP5

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32013 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bone morphogenetic protein 5 is a protein... mehr
Produktinformationen "Anti-BMP5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. Protein function: Induces cartilage and bone formation. [The UniProt Consortium]
Schlagworte: Anti-BMP5, Anti-BMP-5, Anti-Bone morphogenetic protein 5, BMP5 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32013

Eigenschaften

Anwendung: WB, IHC (paraffin), FC, ELISA
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL of human BMP5 were used as the immunogen for the BMP5 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-BMP5"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen