Anti-BD2, aa4-41 (beta Defensin-2)

Anti-BD2, aa4-41 (beta Defensin-2)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
B0901-01B.10 10 µg - -

3 - 19 Werktage*

460,00 €
B0901-01B.100 100 µg - -

3 - 19 Werktage*

1.033,00 €
 
Applications: |Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other... mehr
Produktinformationen "Anti-BD2, aa4-41 (beta Defensin-2)"
Applications: , Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: ELISA: 5ug/ml, Western Blot: 5ug/ml, Immunohistochemistry (paraffin): 1:2000 Requires HIER using sodium citrate buffer pH6.0 and trypsin., Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Anti-BD-2, Anti-SAP1, Anti-hBD-2, Anti-DEFB4A, Anti-DEFB102, Anti-Beta-defensin 2, Anti-Beta-defensin 4A, Anti-Defensin, beta 2, Anti-Skin-antimicrobial peptide 1
Hersteller: United States Biological
Hersteller-Nr: B0901-01B

Eigenschaften

Anwendung: ELISA, IHC, WB
Antikörper-Typ: Monoclonal
Klon: L12-4C-C2
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-BD2, aa4-41 (beta Defensin-2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen