Anti-ATP11C

Anti-ATP11C
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ6040 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ATP11C is an enzyme that in humans is... mehr
Produktinformationen "Anti-ATP11C"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1. Protein function: Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. In the cell membrane of erythrocytes, it is required to maintain phosphatidylserine (PS) in the inner leaflet preventing its exposure on the surface. This asymmetric distribution is critical for the survival of erythrocytes in circulation since externalized PS is a phagocytic signal for splenic macrophages (PubMed:26944472). Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. Required for B cell differentiation past the pro-B cell stage. Seems to mediate PS flipping in pro-B cells. May be involved in the transport of cholestatic bile acids. [The UniProt Consortium]
Schlagworte: Anti-ATPIG, Anti-ATP11C, Anti-ATPase IQ, EC=7.6.2.1, Anti-ATPase class VI type 11C, Anti-Phospholipid-transporting ATPase IG, Anti-P4-ATPase flippase complex alpha subunit ATP11C, ATP11C Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ6040

Eigenschaften

Anwendung: WB, IF, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ATP11C"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen