Anti-ASXL1

Anti-ASXL1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59431.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Probable Polycomb group (PcG) protein involved in transcriptional regulation... mehr
Produktinformationen "Anti-ASXL1"
Protein function: Probable Polycomb group (PcG) protein involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors, such as retinoic acid receptors (RARs) and peroxisome proliferator-activated receptor gamma (PPARG). Acts as coactivator of RARA and RXRA through association with NCOA1. Acts as corepressor for PPARG and suppresses its adipocyte differentiation-inducing activity. Non-catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1). [The UniProt Consortium]
Schlagworte: Anti-ASXL1, Anti-KIAA0978, Anti-Additional sex combs-like protein 1, Anti-Putative Polycomb group protein ASXL1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59431

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse (Erwartet: rat)
Immunogen: Synthetic peptide corresponding to a sequence of Human ASXL1. (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE)
MW: 165 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ASXL1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen