Anti-APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4)

Anti-APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
123425.100 100 µg - -

3 - 19 Werktage*

850,00 €
 
Apolipoprotein C4 is a member of the apolipoprotein family. The gene encoding APOC4 is expressed... mehr
Produktinformationen "Anti-APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4)"
Apolipoprotein C4 is a member of the apolipoprotein family. The gene encoding APOC4 is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 123425

Eigenschaften

Anwendung: ELISA, IP, WB
Antikörper-Typ: Monoclonal
Klon: 3D10
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen