Anti-APOC3 (Apolipoprotein C-III, Apo-CIII, ApoC-III, Apolipoprotein C3)

Anti-APOC3 (Apolipoprotein C-III, Apo-CIII, ApoC-III, Apolipoprotein C3)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
123423.100 100 µg - -

3 - 19 Werktage*

850,00 €
 
Apolipoprotein C-III (Apo CIII) is one of 9 known polymorphic forms of apolipoproteins. The... mehr
Produktinformationen "Anti-APOC3 (Apolipoprotein C-III, Apo-CIII, ApoC-III, Apolipoprotein C3)"
Apolipoprotein C-III (Apo CIII) is one of 9 known polymorphic forms of apolipoproteins. The apolipoproteins functions as stabilizer of the intact lipoprotein particles. Specifically, Apo CIII is a very low density lipoprotein (VLDL) protein. Apo CIII is involved inhibition of lipoprotein lipase and hepatic lipase. It is thought to delay catabolism of triglyceride-rich particles. A defect in Apo CIII has been linked to cause of hyperalphalipoproteinemia (HLAP), which causes increase levels of high density lipoprotein (HDL). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 123423

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 8H7
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-APOC3 (Apolipoprotein C-III, Apo-CIII, ApoC-III, Apolipoprotein C3)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen