Anti-ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1)

Anti-ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
243338.100 100 µg - -

3 - 19 Werktage*

850,00 €
 
Mouse monoclonal antibody raised against a partial recombinant ANGPTL7.||Applications: |Suitable... mehr
Produktinformationen "Anti-ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1)"
Mouse monoclonal antibody raised against a partial recombinant ANGPTL7. Applications: Suitable for use in ELISA, Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSAD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 243338

Eigenschaften

Anwendung: ELISA, IHC, WB
Antikörper-Typ: Monoclonal
Klon: 30000000
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: ANGPTL7 (NP_066969, 27aa-126aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen