Anti-ANGPTL3 (Angiopoietin-related Protein 3, Angiopoietin-5, ANG-5, Angiopoietin-like Protein 3, AN

Angiopoietin-like 3 (ANGPTL3 or ANGPT5), a liver specific protein, is a secreted factor consisting of an N-terminal coiled-coil domain and C-terminal fibrinogen-like domain. ANGPTL3 is structurally similar to angiopoietins, which are vascular endothelial growth factors. ANGTPLs (ANGTPL3, ANGPTL4 and ANGPTL6) have a major impact on lipid and possibly glucose metabolism. These proteins also have important effects on plasma triacylglycerol clearance, adipose tissue lipolysis, and adiposity. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.