Anti-ANGPTL2

Anti-ANGPTL2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32799 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiopoietin-related protein 2, also known... mehr
Produktinformationen "Anti-ANGPTL2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiopoietin-related protein 2, also known as Angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action. Protein function: Induces sprouting in endothelial cells through an autocrine and paracrine action. [The UniProt Consortium]
Schlagworte: Anti-ARP2, Anti-ANGPTL2, Anti-Angiopoietin-like protein 2, Anti-Angiopoietin-related protein 2, ANGPTL2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32799

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids 275-312 (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD) from the human protein
Format: Purified

Datenbank Information

UniProt ID : Q9UKU9 | Passende Produkte
Gene ID : GeneID 23452 | Passende Produkte

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ANGPTL2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen