Anti-AMHR2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32469 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. AMHR2 is the receptor for the... mehr
Produktinformationen "Anti-AMHR2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified. Protein function: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for anti-Muellerian hormone. [The UniProt Consortium]
Schlagworte: Anti-MRII, Anti-AMHR, Anti-AMHR2, Anti-MISRII, EC=2.7.11.30, Anti-MIS type II receptor, Anti-AMH type II receptor, Anti-Anti-Muellerian hormone type-2 receptor, Anti-Anti-Muellerian hormone type II receptor, AMHR2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32469

Eigenschaften

Anwendung: WB, IHC (paraffin), IF, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-AMHR2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen