Anti-alpha Parvin

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59459.50 50 µg - -

10 - 15 Werktage*

551,00 €
 
Protein function: Plays a role in sarcomere organization and in smooth muscle cell contraction.... mehr
Produktinformationen "Anti-alpha Parvin"
Protein function: Plays a role in sarcomere organization and in smooth muscle cell contraction. Required for normal development of the embryonic cardiovascular system, and for normal septation of the heart outflow tract. Plays a role in sprouting angiogenesis and is required for normal adhesion of vascular smooth muscle cells to endothelial cells during blood vessel development. Plays a role in the reorganization of the actin cytoskeleton, formation of lamellipodia and ciliogenesis. Plays a role in the establishement of cell polarity, cell adhesion, cell spreading, and directed cell migration. [The UniProt Consortium]
Schlagworte: Anti-PARVA, Anti-MXRA2, Anti-CH-ILKBP, Anti-Actopaxin, Anti-Alpha-parvin, Anti-Matrix-remodeling-associated protein 2, Anti-Calponin-like integrin-linked kinase-binding protein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59459

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat (Erwartet: mouse, hamster)
Immunogen: Synthetic peptide corresponding to aa. 155-185 of Human alpha Parvin. (QKLQTVLEKINETLKLPPRSIKWNVDSVHAK)
MW: 42 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-alpha Parvin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen