Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
| Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
|---|---|---|---|---|---|---|---|
| NSJ-RQ5956 | 100 µg | - | - |
3 - 10 Werktage* |
790,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Nucleic acid dioxygenase ALKBH1 is an... mehr
Produktinformationen "Anti-ALKBH1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Nucleic acid dioxygenase ALKBH1 is an enzyme that in humans is encoded by the ALKBH1 gene. It is mapped to 14q24.3. This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. Protein function: Dioxygenase that acts as on nucleic acids, such as DNA and tRNA (PubMed:18603530, PubMed:27745969, PubMed:27497299). Requires molecular oxygen, alpha-ketoglutarate and iron (PubMed:18603530, PubMed:27497299). A number of activities have been described for this dioxygenase, but recent results suggest that it mainly acts as on tRNAs and mediates their demethylation or oxidation depending on the context and subcellular compartment (PubMed:27745969, PubMed:27497299). Mainly acts as a tRNA demethylase by removing N(1)-methyladenine from various tRNAs, with a preference for N(1)-methyladenine at position 58 (m1A58) present on a stem loop structure of tRNAs (PubMed:27745969). Acts as a regulator of translation initiation and elongation in response to glucose deprivation: regulates both translation initiation, by mediating demethylation of tRNA(Met), and translation elongation, N(1)- methyladenine-containing tRNAs being preferentially recruited to polysomes to promote translation elongation (PubMed:27745969). In mitochondrion, specifically interacts with mt-tRNA(Met) and mediates oxidation of mt-tRNA(Met) methylated at cytosine(34) to form 5- formylcytosine (f(5)c) at this position (PubMed:27497299). mt-tRNA(Met) containing the f(5)c modification at the wobble position enables recognition of the AUA codon in addition to the AUG codon, expanding codon recognition in mitochondrial translation (PubMed:27497299). Specifically demethylates DNA methylated on the 6th position of adenine (N(6)-methyladenosine) DNA (PubMed:30392959, PubMed:30017583). N(6)- methyladenosine (m6A) DNA is present at some L1 elements in embryonic stem cells and probably promotes their silencing. Demethylates mRNAs containing N(3)-methylcytidine modification (PubMed:31188562). Also able to repair alkylated single-stranded DNA by oxidative demethylation, but with low activity (PubMed:18603530). Also has DNA lyase activity and introduces double-stranded breaks at abasic sites: cleaves both single-stranded DNA and double-stranded DNA at abasic sites, with the greatest activity towards double-stranded DNA with two abasic sites (PubMed:19959401). DNA lyase activity does not require alpha-ketboglutarate and iron and leads to the formation of an irreversible covalent protein-DNA adduct with the 5' DNA product (PubMed:19959401, PubMed:23577621). DNA lyase activity is not required during base excision repair and class switch recombination of the immunoglobulin heavy chain during B lymphocyte activation. May play a role in placental trophoblast lineage differentiation. [The UniProt Consortium]
| Schlagworte: | Anti-DNA lyase ABH1, Anti-DNA 6mA demethylase, Anti-Nucleic acid dioxygenase ALKBH1, Anti-DNA oxidative demethylase ALKBH1, Anti-mRNA N(3)-methylcytidine demethylase, Anti-DNA N6-methyl adenine demethylase ALKBH1, ALKBH1 Antibody |
| Hersteller: | NSJ Bioreagents |
| Hersteller-Nr: | RQ5956 |
Eigenschaften
| Anwendung: | WB, IHC (paraffin), IF, FC |
| Antikörper-Typ: | Polyclonal |
| Konjugat: | No |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
| Immunogen: | Amino acids YLKTARVNMTVRQVLATDQNFPLEPIEDEKRD from the human protein |
| Format: | Purified |
Datenbank Information
| KEGG ID : | K10765 | Passende Produkte |
| UniProt ID : | Q13686 | Passende Produkte |
| Gene ID : | GeneID 8846 | Passende Produkte |
Handhabung & Sicherheit
| Lagerung: | +4°C |
| Versand: | +4°C (International: +4°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ALKBH1"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen