Anti-AKR1B10

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32646 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aldo-keto reductase family 1 member B10 is... mehr
Produktinformationen "Anti-AKR1B10"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. Protein function: Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols (PubMed:9565553, PubMed:18087047, PubMed:12732097, PubMed:19013440, PubMed:19563777). Displays strong enzymatic activity toward all-trans- retinal, 9-cis-retinal, and 13-cis-retinal (PubMed:12732097, PubMed:18087047). Plays a critical role in detoxifying dietary and lipid-derived unsaturated carbonyls, such as crotonaldehyde, 4- hydroxynonenal, trans-2-hexenal, trans-2,4-hexadienal and their glutathione-conjugates carbonyls (GS-carbonyls) (PubMed:19013440, PubMed:19563777). Displays no reductase activity towards glucose (PubMed:12732097). [The UniProt Consortium]
Schlagworte: Anti-ARP, Anti-hARP, Anti-ARL-1, Anti-AKR1B11, Anti-AKR1B10, Anti-SI reductase, Anti-Aldose reductase-like, Anti-Small intestine reductase, Anti-Aldose reductase-related protein, Anti-Aldo-keto reductase family 1 member B10, AKR1B10 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32646

Eigenschaften

Anwendung: WB, IHC (paraffin), IF
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: amino acids 285-316 (EMATILSFNRNWRACNVLQSSHLEDYPFNAEY) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-AKR1B10"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen