Anti-AKAP2

Anti-AKAP2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32805 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. A-kinase anchor protein 2 is an enzyme... mehr
Produktinformationen "Anti-AKAP2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene. Protein function: Binds to regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify and focus diffuse, trans-cellular signals carried by cAMP. [The UniProt Consortium]
Schlagworte: Anti-AKAP2, Anti-PRKA2, Anti-AKAP-2, Anti-AKAP-KL, Anti-KIAA0920, Anti-A-kinase anchor protein 2, Anti-Protein kinase A-anchoring protein 2, AKAP2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32805

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-AKAP2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen