Anti-AFP (Alpha-fetoprotein, Alpha-1-fetoprotein, Alpha-fetoglobulin, HPAFP)

Anti-AFP (Alpha-fetoprotein, Alpha-1-fetoprotein, Alpha-fetoglobulin, HPAFP)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
123049.100 100 µg - -

3 - 19 Werktage*

699,00 €
 
Alpha-fetoprotein (AFP) is a serum glycoprotein protein produced in the liver or yolk sac of... mehr
Produktinformationen "Anti-AFP (Alpha-fetoprotein, Alpha-1-fetoprotein, Alpha-fetoglobulin, HPAFP)"
Alpha-fetoprotein (AFP) is a serum glycoprotein protein produced in the liver or yolk sac of fetal staged mammals. AFP synthesis is minimal after birth and trace amount is expressed in the adult liver. AFP gene expression is regulated by the interactions between steroid hormone receptors and transcriptional factors in separate signal transduction pathways. AFP functions as a binding and transporting ligand and cell growth regulator. An elevated expression level of AFP has been implicated in colorectal, ovarian, pancreatic, testicular, and certain liver cancers. High level of AFP is also seen some diseases, such as hepatitis and colitis. AFP is used as a screening marker for fetal abnormalities in pregnant women, such as Down syndrome. Recently, AFP has been introduced as an anti-cancer drug-ligand carrier, transporting drugs to target tumor cells, increasing anti-tumor efficiency. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 123049

Eigenschaften

Anwendung: ELISA, IF, IP, WB
Antikörper-Typ: Monoclonal
Klon: 1G7
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa500-609 from human AFP (AAH27881) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-AFP (Alpha-fetoprotein, Alpha-1-fetoprotein, Alpha-fetoglobulin, HPAFP)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen