Anti-ADAM28

Anti-ADAM28
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32798 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Disintegrin and metalloproteinase... mehr
Produktinformationen "Anti-ADAM28"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants. Protein function: May play a role in the adhesive and proteolytic events that occur during lymphocyte emigration or may function in ectodomain shedding of lymphocyte surface target proteins, such as FASL and CD40L. May be involved in sperm maturation. [The UniProt Consortium]
Schlagworte: Anti-MDC-L, Anti-ADAM23, Anti-ADAM28, Anti-eMDC II, Anti-ADAM 28, EC=3.4.24.-, Anti-Disintegrin and metalloproteinase domain-containing protein 28, Anti-Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L, ADAM28 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32798

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids 207-248 (EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ADAM28"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen