Anti-Aconitase 2

Anti-Aconitase 2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32458 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aconitase 2, mitochondrial is a protein... mehr
Produktinformationen "Anti-Aconitase 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. Protein function: Catalyzes the isomerization of citrate to isocitrate via cis- aconitate. [The UniProt Consortium]
Schlagworte: Anti-ACO2, Anti-Aconitase, Anti-Citrate hydro-lyase, Anti-Aconitate hydratase, mitochondrial, Aconitase 2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32458

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein
Format: Purified

Datenbank Information

KEGG ID : K01681 | Passende Produkte
UniProt ID : Q99798 | Passende Produkte
Gene ID : GeneID 50 | Passende Produkte

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Aconitase 2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen