Anti-ABCB10

Anti-ABCB10
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32456 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ABCB10, also known as M-ABC2, is expressed... mehr
Produktinformationen "Anti-ABCB10"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ABCB10, also known as M-ABC2, is expressed as a 65-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. Protein function: May mediate critical mitochondrial transport functions related to heme biosynthesis. [The UniProt Consortium]
Schlagworte: Anti-M-ABC2, Anti-ABCB10, Anti-ABC transporter 10 protein, Anti-ATP-binding cassette transporter 10, Anti-Mitochondrial ATP-binding cassette 2, Anti-ATP-binding cassette sub-family B member 10, mitochondrial, ABCB10 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32456

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids 640-678 (QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ABCB10"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen