- Suchergebnis für Q9Y5B8
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9Y5B8" wurden 19 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA028334.100
Polyclonal Antibody against Human NME7, Gene description: NME/NM23 family member 7, Alternative Gene Names: CFAP67, FLJ37194, NM23-H7, Validated applications: ICC, WB, Uniprot ID: Q9Y5B8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Major role in the...
Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7 |
Anwendung: | ICC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: CSB-PA250757.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: NME7. Antigen Species: Human
Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 167,00 €
Artikelnummer: ATA-HPA038014.100
Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is...
Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7 |
Anwendung: | IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 358,00 €
Artikelnummer: ATA-HPA054289.100
Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is...
Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7 |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 239,00 €
Artikelnummer: NSJ-F54961-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells,...
Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, NME7 Antibody /... |
Anwendung: | WB, IHC (paraffin) |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 350,00 €

Artikelnummer: ATA-APrEST95650.100
PrEST Antigen NME7, Gene description: NME/NM23 family member 7, Alternative Gene Names: CFAP67, FLJ37194, NM23-H7, Antigen sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Schlagworte: | NME7, NDK 7, nm23-H7, EC=2.7.4.6, NDP kinase 7, Nucleoside diphosphate kinase 7 |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: ABS-PP-12048.100
Schlagworte: | Nucleoside diphosphate kinase 7, NDK 7, NDP kinase 7, nm23-H7, Recombinant Human NME7 Protein |
MW: | 22 kD |
ab 90,00 €

Artikelnummer: CSB-PA897289LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA897289LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
ab 167,00 €

Artikelnummer: CSB-PA897289LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA897289LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-CL897289HU.10
Length: 1131 Sequence: atgaatcata gtgaaagatt cgttttcatt gcagagtggt atgatccaaa tgcttcactt cttcgacgtt atgagctttt attttaccca ggggatggat ctgttgaaat gcatgatgta aagaatcatc gcaccttttt aaagcggacc aaatatgata acctgcactt ggaagattta tttataggca acaaagtgaa tgtcttctct cgacaactgg tattaattga ctatggggat caatatacag ctcgccagct...
Schlagworte: | NME7, NDK 7, nm23-H7, EC=2.7.4.6, NDP kinase 7, Nucleoside diphosphate kinase 7 |
Anwendung: | Molecular biology, clone |
Spezies-Reaktivität: | human |
176,00 €