Zu "Q9Y5B8" wurden 19 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-NME7
Artikelnummer: ATA-HPA028334.100
Polyclonal Antibody against Human NME7, Gene description: NME/NM23 family member 7, Alternative Gene Names: CFAP67, FLJ37194, NM23-H7, Validated applications: ICC, WB, Uniprot ID: Q9Y5B8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Major role in the...
| Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7 |
| Anwendung: | ICC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Anti-NME7
Artikelnummer: CSB-PA250757.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: NME7. Antigen Species: Human
| Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 167,00 €
Anti-NME7
Artikelnummer: ATA-HPA038014.100
Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is...
| Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7 |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 358,00 €
Anti-NME7
Artikelnummer: ATA-HPA054289.100
Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is...
| Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 239,00 €
Anti-NME7 / Nucleoside diphosphate kinase 7
Artikelnummer: NSJ-F54961-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells,...
| Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, NME7 Antibody /... |
| Anwendung: | WB, IHC (paraffin) |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 350,00 €
NME7 PrEST Antigen
Artikelnummer: ATA-APrEST95650.100
PrEST Antigen NME7, Gene description: NME/NM23 family member 7, Alternative Gene Names: CFAP67, FLJ37194, NM23-H7, Antigen sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Schlagworte: | NME7, NDK 7, nm23-H7, EC=2.7.4.6, NDP kinase 7, Nucleoside diphosphate kinase 7 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
NME7 (human), recombinant protein
Artikelnummer: ABS-PP-12048.100
| Schlagworte: | Nucleoside diphosphate kinase 7, NDK 7, NDP kinase 7, nm23-H7, Recombinant Human NME7 Protein |
| MW: | 22 kD |
ab 90,00 €
Anti-NME7, FITC conjugated
Artikelnummer: CSB-PA897289LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
| Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-NME7
Artikelnummer: CSB-PA897289LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
| Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 167,00 €
Anti-NME7, HRP conjugated
Artikelnummer: CSB-PA897289LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
| Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-NME7, Biotin conjugated
Artikelnummer: CSB-PA897289LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: NME7. Antigen Species: Human
| Schlagworte: | Anti-NME7, Anti-NDK 7, Anti-nm23-H7, EC=2.7.4.6, Anti-NDP kinase 7, Anti-Nucleoside diphosphate kinase 7, MN23H7 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
NME7 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL897289HU.10
Length: 1131 Sequence: atgaatcata gtgaaagatt cgttttcatt gcagagtggt atgatccaaa tgcttcactt cttcgacgtt atgagctttt attttaccca ggggatggat ctgttgaaat gcatgatgta aagaatcatc gcaccttttt aaagcggacc aaatatgata acctgcactt ggaagattta tttataggca acaaagtgaa tgtcttctct cgacaactgg tattaattga ctatggggat caatatacag ctcgccagct...
| Schlagworte: | NME7, NDK 7, nm23-H7, EC=2.7.4.6, NDP kinase 7, Nucleoside diphosphate kinase 7 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €