Zu "Q64373" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
BCL-XL Protein, Mouse, Recombinant (aa 1-212, His)
Artikelnummer: TGM-TMPY-02564-100ug
Description: BCL-XL Protein, Mouse, Recombinant (aa 1-212, His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 25.2 kDa and the accession number is Q64373-1.
| Schlagworte: | BclX, Bcl2l, bcl-x, Bcl-XL, Bcl(X)L, BCL2-like 1, bcl2-L-1 |
| MW: | 25.2 kD |
699,00 €
Mouse Bcl2L (B-Cell CLL/Lymphoma 2 Like Protein) ELISA Kit
Artikelnummer: ELK-ELK7209.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse Bcl2L. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse Bcl2L. Next,...
| Schlagworte: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
ab 374,00 €
Recombinant Mouse BCL2L1/Bcl-XL Protein (aa 1-212, His...
Artikelnummer: G-RPES4233.100
Mouse BCL2L1/Bcl-XL Recombinant Protein (RPES4233) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage- dependent anion channel (VDAC)...
| Schlagworte: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
1.465,00 €
Bcl2L1, Mouse BCL2-like 1, Real Time PCR Primer Set
Artikelnummer: VMPS-628
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
| Anwendung: | RNA quantification |
44,00 €
B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L) BioAssay(TM)...
Artikelnummer: 152329.96
B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L) BioAssay(TM) ELISA Kit (Mouse) is a Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L). Standards or samples are then added to the appropriate microtiter plate...
| Schlagworte: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.039,00 €
B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L) Recombinant,...
Artikelnummer: 153643.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q64373, Fragment: Ser2~Arg212 (Accession No: Q64373), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SQSNRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEE TEAERETPSA INGNPSWHLA DSPAVNGATG HSSSLDAREV...
ab 379,00 €
Bcl-2-like-Protein 1, Recombinant, Mouse, aa1-209,...
Artikelnummer: 351102.100
BCL2L1 also known as Bcl-2-like protein 1 isoform a. This protein is a member of BCL-2 protein family. BCL2L1 is located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. Also, BCL2L1 controls a switch between cell death modes during mitotic...
| Schlagworte: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X |
| Ursprungsart: | mouse |
| MW: | 25.8 kD |
ab 581,00 €
BCL2L1 / Bcl-XL Protein (aa 1-212, His tag) (recombinant...
Artikelnummer: E-PKSM040918.100
Activity: 1. Measured by its binding ability in a functional ELISA.2. Immobilized human BID at 10 µg/mL (100 µl/well) can bind biotinylated mouse BCL2L1, The EC50 of biotinylated mouse BCL2L1 is 5.6 ng/mL.3. Immobilized mouse BID at 10 µg/mL (100 µl/well) can bind biotinylated mouse BCL2L1, The EC50 of...
| Schlagworte: | Bcl2l, Bcl2l1, Bcl2-L-1, Bcl-2-like protein 1, Apoptosis regulator Bcl-X, Recombinant Mouse BCL2L1 / Bcl-XL Protein (aa... |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 25.2 kD |
1.435,00 €