IL-28B protein(N-His)(active) (recombinant mouse)

IL-28B protein(N-His)(active) (recombinant mouse)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
E-PKSM041474.20 20 µg -

7 - 16 Werktage*

241,00 €
E-PKSM041474.100 100 µg -

7 - 16 Werktage*

632,00 €
 
Activity: Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC)... mehr
Produktinformationen "IL-28B protein(N-His)(active) (recombinant mouse)"
Activity: Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <20 ng/mL. Sequence: MLLLLLPLLLAAVLTRTQADPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)- induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression. [The UniProt Consortium]
Schlagworte: Il28, Ifnl3, IL-28B, IFN-lambda-3, Interleukin-28B, Interferon lambda-3, Recombinant Mouse IL-28B protein(N-His)(active)
Hersteller: Elabscience
Hersteller-Nr: E-PKSM041474

Eigenschaften

Anwendung: Active, cell culture
Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: mouse
MW: 22.49 kD
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: -80°C
Versand: +4°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "IL-28B protein(N-His)(active) (recombinant mouse)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen