IL-17B protein(N-His)(active) (recombinant mouse)

Activity: Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL. Sequence: MDWPHSLLFLLAISIFLAPSHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Stimulates the release of tumor necrosis factor alpha and IL- 1-beta from the monocytic cell line THP-1. [The UniProt Consortium]