IL-15 protein(N-His)(active) (recombinant swine)

IL-15 protein(N-His)(active) (recombinant swine)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
E-PKSS000008.20 20 µg -

7 - 16 Werktage*

435,00 €
 
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect... mehr
Produktinformationen "IL-15 protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <5.5 ng/mL. Sequence: MRILKPCLRSTCIQCYLCLLLNSHFLTEDGIHVFILGCISAGLPKTEATWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems. Stimulates the proliferation of natural killer cells, T-cells and B-cells and promotes the secretion of several cytokines. In monocytes, induces the production of IL8 and monocyte chemotactic protein 1/CCL2, two chemokines that attract neutrophils and monocytes respectively to sites of infection. Unlike most cytokines, which are secreted in soluble form, IL15 is expressed in association with its high affinity IL15RA on the surface of IL15-producing cells and delivers signals to target cells that express IL2RB and IL2RG receptor subunits. Binding to its receptor triggers the phosphorylation of JAK1 and JAK3 and the recruitment and subsequent phosphorylation of signal transducer and activator of transcription-3/STAT3 and STAT5. In mast cells, induces the rapid tyrosine phosphorylation of STAT6 and thereby controls mast cell survival and release of cytokines such as IL4. [The UniProt Consortium]
Schlagworte: IL15, IL-15, Interleukin-15, Recombinant Swine IL-15 protein(N-His)(active)
Hersteller: Elabscience
Hersteller-Nr: E-PKSS000008

Eigenschaften

Anwendung: Active, Cell culture
Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: swine
MW: 19.26 kD
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: -80°C
Versand: 4°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "IL-15 protein(N-His)(active) (recombinant swine)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen