CD30L protein(N-His)(active) (recombinant human)

Artikelnummer	Größe	Datenblatt	Manual	SDB	Lieferzeit	Menge	Preis
E-PKSH034123.20	20 µg		-		7 - 16 Werktage*		241,00 €
E-PKSH034123.100	100 µg		-		7 - 16 Werktage*		632,00 €

Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage

Activity: Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this... mehr

Menü schließen

Produktinformationen "CD30L protein(N-His)(active) (recombinant human)"

Activity: Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <2 ng/mL. Sequence: MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD. Fusion tag: N-His Endotoxin: <0.01 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells. [The UniProt Consortium]

Schlagworte:	CD153, CD30L, TNFSF8, CD30-L, CD30 ligand, Tumor necrosis factor ligand superfamily member 8, Recombinant Human CD30L protein(N-His)(active)
Hersteller:	Elabscience
Hersteller-Nr:	E-PKSH034123

Eigenschaften

Anwendung:	Active, cell culture
Konjugat:	No
Wirt:	E.coli
Spezies-Reaktivität:	human
MW:	26.85 kD
Format:	Lyophilized

Datenbank Information

KEGG ID :	K05471 \| Passende Produkte
UniProt ID :	P32971 \| Passende Produkte
Gene ID :	GeneID 944 \| Passende Produkte

Handhabung & Sicherheit

Lagerung:	-80°C
Versand:	+4°C (International: -20°C)

Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!

Hier folgen Informationen zur Produktreferenz. mehr

Menü schließen

View product citations for antibody E-PKSH034123 on CiteAb

Hier kriegen Sie ein Zertifikat

Zurück

Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.

Bewertungen lesen, schreiben und diskutieren... mehr

Menü schließen

Kundenbewertungen für "CD30L protein(N-His)(active) (recombinant human)"

Bewertung schreiben

Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.