Beta Defensin 2, Human, aa4-41 (Beta-Defensin 2, beta 2, BD-2, Skin-Antimicrobial Peptide, SAP1)

Has antibacterial activity. Source: Synthetic human Beta Defensin 2, AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.