Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)

Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
298243.100 100 µg - -

3 - 19 Werktage*

449,00 €
298243.1 1 mg - -

3 - 19 Werktage*

1.163,00 €
 
Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis,... mehr
Produktinformationen "Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)"
Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Source: Synthetic human Pro-Atrial Natriuretic Peptide, aa1-30, AA Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLED, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: ANP, NPPA
Hersteller: United States Biological
Hersteller-Nr: 298243

Eigenschaften

Konjugat: No
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen