MSMO1 PrEST Antigen

PrEST Antigen MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Antigen sequence: VHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the three-step monooxygenation required for the demethylation of 4,4-dimethyl and 4alpha-methylsterols, which can be subsequently metabolized to cholesterol (PubMed:21285510, PubMed:28673550, PubMed:23583456, PubMed:26114596). Also involved in drug metabolism, as it can metabolize eldecalcitol (ED-71 or 1alpha,25- dihydroxy-2beta-(3-hydroxypropoxy)-cholecalciferol), a second- generation vitamin D analog, into 1alpha,2beta,25-trihydroxy vitamin D3, this reaction occurs via enzymatic hydroxylation and spontaneous O- dehydroxypropylation (PubMed:26038696). [The UniProt Consortium] Mouse gene identity: 87% Rat gene identity: 87%