- Suchergebnis für Q15800
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q15800" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: E-AB-16412.120
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to...
| Schlagworte: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1, MSMO1 Polyclonal Antibody |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 89,00 €
Artikelnummer: ATA-HPA056127.100
Protein function: Catalyzes the three-step monooxygenation required for the demethylation of 4,4-dimethyl and 4alpha-methylsterols, which can be subsequently metabolized to cholesterol (PubMed:21285510, PubMed:28673550, PubMed:23583456, PubMed:26114596). Also involved in drug metabolism, as it can metabolize...
| Schlagworte: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: CSB-PA955910.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: MSMO1. Antigen Species: Human
| Schlagworte: | Anti-MSMO1, Anti-DESP4, Anti-Sterol-C4-methyl oxidase, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA972591.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: MSMO1. Antigen Species: Human
| Schlagworte: | Anti-MSMO1, Anti-DESP4, Anti-Sterol-C4-methyl oxidase, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ATA-HPA055073.100
Polyclonal Antibody against Human MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Validated applications: ICC, Uniprot ID: Q15800, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalyzes the three-step...
| Schlagworte: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA055073.25
Polyclonal Antibody against Human MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Validated applications: ICC, Uniprot ID: Q15800, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalyzes the three-step...
| Schlagworte: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: VHPS-8119
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | DESP4, SC4MOL, EC=1.14.13.72, C-4 methylsterol oxidase, Methylsterol monooxygenase |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: 035202.200
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to...
| Schlagworte: | Anti-MSMO1, Anti-DESP4, EC=1.14.13.72, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1 |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ATA-APrEST85272.100
Protein function: Catalyzes the three-step monooxygenation required for the demethylation of 4,4-dimethyl and 4alpha-methylsterols, which can be subsequently metabolized to cholesterol (PubMed:21285510, PubMed:28673550, PubMed:23583456, PubMed:26114596). Also involved in drug metabolism, as it can metabolize...
| Schlagworte: | DESP4, MSMO1, C-4 methylsterol oxidase, Sterol-C4-methyl oxidase, Methylsterol monooxygenase 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES14699.100
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to...
| Schlagworte: | Anti-MSMO1, Anti-DESP4, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
Artikelnummer: ATA-APrEST95657.100
PrEST Antigen MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Antigen sequence: VHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the three-step...
| Schlagworte: | MSMO1, DESP4, C-4 methylsterol oxidase, Sterol-C4-methyl oxidase, Methylsterol monooxygenase 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €