KMT5C PrEST Antigen

KMT5C PrEST Antigen
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ATA-APrEST96006.100 100 µl

7 - 10 Werktage*

264,00 €
 
PrEST Antigen KMT5C, Gene description: lysine methyltransferase 5C, Alternative Gene Names:... mehr
Produktinformationen "KMT5C PrEST Antigen"
PrEST Antigen KMT5C, Gene description: lysine methyltransferase 5C, Alternative Gene Names: MGC2705, SUV420H2, Antigen sequence: THKMNVSPVPPLRRQQHLRSALETFLRQRDLEAAYRALTLGGWTARYFQSR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Histone methyltransferase that specifically methylates monomethylated 'Lys-20' (H4K20me1) and dimethylated 'Lys-20' (H4K20me2) of histone H4 to produce respectively dimethylated 'Lys-20' (H4K20me2) and trimethylated 'Lys-20' (H4K20me3) and thus regulates transcription and maintenance of genome integrity (PubMed:24396869, PubMed:28114273). In vitro also methylates unmodified 'Lys-20' (H4K20me0) of histone H4 and nucleosomes (PubMed:24396869). H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. KMT5C is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2). Facilitates TP53BP1 foci formation upon DNA damage and proficient non-homologous end-joining (NHEJ)-directed DNA repair by catalyzing the di- and trimethylation of 'Lys-20' of histone H4 (PubMed:28114273). May play a role in class switch reconbination by catalyzing the di- and trimethylation of 'Lys-20' of histone H4. [The UniProt Consortium] Mouse gene identity: 88% Rat gene identity: 88%
Schlagworte: PP7130, SUV420H2, Suv4-20h2, Su(var)4-20 homolog 2, Lysine N-methyltransferase 5C, Lysine-specific methyltransferase 5C, Suppressor of variegation 4-20 homolog 2, Histone-lysine N-methyltransferase KMT5C, [histone H4]-lysine20 N-methyltransferase KMT5B
Hersteller: Atlas Antibodies
Hersteller-Nr: APrEST96006

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Solution

Handhabung & Sicherheit

Lagerung: -20°C (avoid repeat freezing and thawing cycles)
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "KMT5C PrEST Antigen"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen