Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe

Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
H1821-25C.10 10 µg - -

3 - 19 Werktage*

889,00 €
 
Post-translational modifications of conserved N-terminal tail residues in histones regulate many... mehr
Produktinformationen "Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe"
Post-translational modifications of conserved N-terminal tail residues in histones regulate many aspects of chromosome activity. Mitotic phosphorylation of H3 Thr 3 occurs in prophase and dephosphorylation during anaphase. Haspin, a dual serine/threonine kinase, plays an important role in regulation of chromosome and spindle function during mitosis and meiosis via its function in phosphorylation of the threonine residue in the third position of histone 3 (Thr3). Source: Human GSG2 partial ORF (NP_114171, aa699-798, recombinant protein with GST-tag at N-terminal. Sequence: VFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK , Theoretical MW (kD): 36.63, Preparation Method: In vitro wheat germ expression system, Quality Control: 12.5% SDS-PAGE Stained with Coomassie Blue, Storage and Stability: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Schlagworte: GSG2, H-haspin, EC=2.7.11.1, Germ cell-specific gene 2 protein, Serine/threonine-protein kinase haspin, Haploid germ cell-specific nuclear protein kinase
Hersteller: United States Biological
Hersteller-Nr: H1821-25C

Eigenschaften

Konjugat: No
Spezies-Reaktivität: human
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -80°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Haspin, Recombinant, Human (H-Haspin, Germ Cell-specific Gene 2 Protein, GSG2, Haploid Germ Cell-spe"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen