GRIA4 PrEST Antigen

PrEST Antigen GRIA4, Gene description: glutamate ionotropic receptor AMPA type subunit 4, Alternative Gene Names: GluA4, GLUR4, GLURD, Antigen sequence: NGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate. [The UniProt Consortium] Mouse gene identity: 100% Rat gene identity: 100%