ESX1 PrEST Antigen

PrEST Antigen ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Antigen sequence: MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which is present within the first intron of the KRAS gene and inhibits its expression. ESXR1-C has the ability to inhibit cyclin turnover. [The UniProt Consortium] Mouse gene identity: 28% Rat gene identity: 28%