Zu "Q8N693" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ESX1
Artikelnummer: 600-401-BC1
Anti-ESX1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with ESX1 from other sources has not been determined. Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of...
| Schlagworte: | Anti-ESX1, Anti-ESX1L |
| Anwendung: | ELISA, IHC, IFM, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
848,00 €
Anti-ESX1
Artikelnummer: ATA-HPA051992.100
Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
| Schlagworte: | Anti-ESX1, Anti-ESX1L |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-ESX1
Artikelnummer: ATA-HPA073330.100
Polyclonal Antibody against Human ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Validated applications: IHC, Uniprot ID: Q8N693, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May coordinately regulate cell cycle progression...
| Schlagworte: | Anti-ESX1, Anti-ESX1L |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Anti-ESX1
Artikelnummer: ATA-HPA073330.25
Polyclonal Antibody against Human ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Validated applications: IHC, Uniprot ID: Q8N693, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May coordinately regulate cell cycle progression...
| Schlagworte: | Anti-ESX1, Anti-ESX1L |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
ESX1 Antibody
Artikelnummer: G-PACO09149.100
ESX1 Antibody is a premium polyclonal that offers outstanding performance and reliability for demanding research applications. Rigorously validated for ELISA, WB, this antibody ensures consistent, reproducible results across multiple experimental platforms. Demonstrates excellent reactivity with Human, Mouse...
| Schlagworte: | Anti-ESX1, Anti-Homeobox protein ESX1, Anti-Extraembryonic, spermatogenesis, homeobox 1 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
1.124,00 €
ESX1 (human), recombinant protein
Artikelnummer: ABS-PP-10621-L.100
Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
| Schlagworte: | Homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1) [Cleaved into: Homeobox protein ESX1-N, Homeobox... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 115,00 €
Anti-ESX1, NT (ESX1, ESX1L, ESX1R, Homeobox protein ESX1,...
Artikelnummer: 035244.200
This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain. The C-terminal fragment localizes to the cytoplasm while the N-terminal fragment localizes...
| Schlagworte: | Anti-ESX1, Anti-ESX1L |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
ESX1 PrEST Antigen
Artikelnummer: ATA-APrEST83912.100
Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
| Schlagworte: | ESX1, ESX1L |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-ESX1
Artikelnummer: ELK-ES16662.100
This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain. The C-terminal fragment localizes to the cytoplasm while the N-terminal fragment localizes...
| Schlagworte: | Anti-ESX1, Anti-ESX1L, ESX1 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Anti-ESX1
Artikelnummer: CSB-PA007838GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: ESX1. Antigen Species: Human
| Schlagworte: | Anti-ESX1, Anti-ESX1L, ESX1 antibody, ESX1L antibody, ESX1R antibody, Homeobox protein ESX1 antibody, Extraembryonic... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
552,00 €
ESX1 (human), recombinant protein
Artikelnummer: ABS-PP-10621.100
Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
| Schlagworte: | Homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1) [Cleaved into: Homeobox protein ESX1-N, Homeobox... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 90,00 €
ESX1 PrEST Antigen
Artikelnummer: ATA-APrEST96154.100
PrEST Antigen ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Antigen sequence: MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May coordinately regulate cell cycle...
| Schlagworte: | ESX1, ESX1L |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €