CD1E PrEST Antigen

PrEST Antigen CD1E, Gene description: CD1e molecule, Antigen sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl inositides and diacylated sulfoglycolipids, and is required for the presentation of glycolipid antigens on the cell surface. The membrane-associated form is not active. [The UniProt Consortium] Mouse gene identity: 42% Rat gene identity: 42%