BBS2 PrEST Antigen

BBS2 PrEST Antigen
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ATA-APrEST96065.100 100 µl

7 - 10 Werktage*

264,00 €
 
PrEST Antigen BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS,... mehr
Produktinformationen "BBS2 PrEST Antigen"
PrEST Antigen BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Antigen sequence: VVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. The BBSome complex, together with the LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. Required for proper BBSome complex assembly and its ciliary localization. [The UniProt Consortium] Mouse gene identity: 82% Rat gene identity: 82%
Schlagworte: BBS2, Bardet-Biedl syndrome 2 protein
Hersteller: Atlas Antibodies
Hersteller-Nr: APrEST96065

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
Format: Solution

Handhabung & Sicherheit

Lagerung: -20°C (avoid repeat freezing and thawing cycles)
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "BBS2 PrEST Antigen"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen