Zu "K16747" wurden 15 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-BBS2
Anti-BBS2

Artikelnummer: ATA-HPA041315.100

Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
Schlagworte: Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-BBS2
Anti-BBS2

Artikelnummer: ATA-HPA040961.100

Polyclonal Antibody against Human BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Validated applications: ICC, Uniprot ID: Q9BXC9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: The BBSome complex is thought to function as a...
Schlagworte: Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-BBS2
Anti-BBS2

Artikelnummer: ATA-HPA059900.100

Polyclonal Antibody against Human BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Validated applications: ICC, Uniprot ID: Q9BXC9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: The BBSome complex is thought to function as a...
Schlagworte: Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
BBS2 (human), recombinant protein
BBS2 (human), recombinant protein

Artikelnummer: ABS-PP-6173-L.100

Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
Schlagworte: Bardet-Biedl syndrome 2 protein, Recombinant Human BBS2 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 15 kD
ab 115,00 €
Bewerten
BBS2 PrEST Antigen
BBS2 PrEST Antigen

Artikelnummer: ATA-APrEST82169.100

Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
Schlagworte: BBS2, Bardet-Biedl syndrome 2 protein
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-BBS2
Anti-BBS2

Artikelnummer: G-CAB7425.20

Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
Schlagworte: Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat
103,00 €
Bewerten
Anti-BBS2
Anti-BBS2

Artikelnummer: ELK-ES18093.100

This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse and...
Schlagworte: Anti-Bardet-Biedl syndrome 2 protein, BBS2 rabbit pAb
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 173,00 €
Bewerten
BBS2 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC, A
BBS2 (Vector Vector will be determined during the...

Artikelnummer: CSB-CL866303HU.10

Length: 2166 Sequence: atgctgctgc ctgtgttcac cctgaaactg cgccacaaaa tcagcccccg aatggtggcc atagggcgct acgacgggac tcacccgtgc ctggcggccg ccacccaaac gggcaaggtt tttattcata atcctcatac acggaaccag catgtcagtg catccagggt cttccagagc cccctggaat ctgatgtttc tcttctcaac attaaccagg cagtcagctg tctgactgca ggcgtattga accctgagct...
Schlagworte: BBS2, Bardet-Biedl syndrome 2 protein
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
482,00 €
Bewerten
Anti-BBS2
Anti-BBS2

Artikelnummer: CSB-PA866303ESR1HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: BBS2. Antigen Species: Human
Schlagworte: Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein, BBS2Bardet-Biedl syndrome 2 protein antibody, BBS2 Antibody
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 167,00 €
Bewerten
Anti-BBS2
Anti-BBS2

Artikelnummer: CSB-PA866303ESR2HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: BBS2. Antigen Species: Human
Schlagworte: Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein, BBS2Bardet-Biedl syndrome 2 protein antibody, BBS2 Antibody
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
BBS2 (human), recombinant protein
BBS2 (human), recombinant protein

Artikelnummer: ABS-PP-6173.100

Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
Schlagworte: Bardet-Biedl syndrome 2 protein, Recombinant Human BBS2 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 15 kD
ab 90,00 €
Bewerten
BBS2 PrEST Antigen
BBS2 PrEST Antigen

Artikelnummer: ATA-APrEST96065.100

PrEST Antigen BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Antigen sequence: VVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: The BBSome complex is...
Schlagworte: BBS2, Bardet-Biedl syndrome 2 protein
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
1 von 2 Seiten