- Suchergebnis für K16747
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K16747" wurden 15 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA041315.100
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Schlagworte: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA040961.100
Polyclonal Antibody against Human BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Validated applications: ICC, Uniprot ID: Q9BXC9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: The BBSome complex is thought to function as a...
| Schlagworte: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA059900.100
Polyclonal Antibody against Human BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Validated applications: ICC, Uniprot ID: Q9BXC9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: The BBSome complex is thought to function as a...
| Schlagworte: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-6173-L.100
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Schlagworte: | Bardet-Biedl syndrome 2 protein, Recombinant Human BBS2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 115,00 €
Artikelnummer: ATA-APrEST82169.100
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Schlagworte: | BBS2, Bardet-Biedl syndrome 2 protein |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: G-CAB7425.20
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Schlagworte: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse, rat |
103,00 €
Artikelnummer: ELK-ES18093.100
This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse and...
| Schlagworte: | Anti-Bardet-Biedl syndrome 2 protein, BBS2 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
Artikelnummer: CSB-CL866303HU.10
Length: 2166 Sequence: atgctgctgc ctgtgttcac cctgaaactg cgccacaaaa tcagcccccg aatggtggcc atagggcgct acgacgggac tcacccgtgc ctggcggccg ccacccaaac gggcaaggtt tttattcata atcctcatac acggaaccag catgtcagtg catccagggt cttccagagc cccctggaat ctgatgtttc tcttctcaac attaaccagg cagtcagctg tctgactgca ggcgtattga accctgagct...
| Schlagworte: | BBS2, Bardet-Biedl syndrome 2 protein |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
482,00 €
Artikelnummer: CSB-PA866303ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: BBS2. Antigen Species: Human
| Schlagworte: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein, BBS2Bardet-Biedl syndrome 2 protein antibody, BBS2 Antibody |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 167,00 €
Artikelnummer: CSB-PA866303ESR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: BBS2. Antigen Species: Human
| Schlagworte: | Anti-BBS2, Anti-Bardet-Biedl syndrome 2 protein, BBS2Bardet-Biedl syndrome 2 protein antibody, BBS2 Antibody |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ABS-PP-6173.100
Protein function: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP...
| Schlagworte: | Bardet-Biedl syndrome 2 protein, Recombinant Human BBS2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST96065.100
PrEST Antigen BBS2, Gene description: Bardet-Biedl syndrome 2, Alternative Gene Names: BBS, Antigen sequence: VVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: The BBSome complex is...
| Schlagworte: | BBS2, Bardet-Biedl syndrome 2 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €