- Suchergebnis für U3KNX2
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "U3KNX2" wurden 8 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: RP2576U-005
The Rabbit CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit CXCL9 yeast-derived recombinant protein can be...
| Schlagworte: | CXCL9, C-X-C motif chemokine |
| Anwendung: | Bioassays |
| Exprimiert in: | Yeast |
| Ursprungsart: | rabbit |
| MW: | 11.6 kD |
ab 233,00 €
Artikelnummer: DIY2579U-003
The Rabbit CXCL9 (MIG) ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit CXCL9 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for the...
| Schlagworte: | CXCL9, C-X-C motif chemokine |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rabbit |
ab 1.098,00 €
Artikelnummer: KPB1306U-050
| Schlagworte: | Anti-C-X-C motif chemokine |
| Anwendung: | ELISA |
| Wirt: | Chicken |
| Spezies-Reaktivität: | rabbit |
549,00 €
Artikelnummer: CSB-EP006252RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: E.coli. Expression Region: 23-124aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: SPIMRNGRCS CISSTQGKIH LQSLKDLKQF SPSPSCGKTE IIATKKDGTQ ICLNPDSTEV KELVEKWKKQ SSPKKKQKKG KKQRKVKKSL KKSQRPHQKK TA....
| Schlagworte: | C-X-C motif chemokine, Recombinant Rabbit C-X-C motif chemokine (CXCL9) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | rabbit |
| MW: | 27.5 kD |
ab 364,00 €
Artikelnummer: 372938.100
Source:, Recombinant protein corresponding to aa23-124 from rabbit CXCL9, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD, AA Sequence: SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA, Storage and Stability: May be stored at...
| Schlagworte: | C-X-C motif chemokine |
| MW: | 27,5 |
ab 786,00 €
Artikelnummer: KP1305U-020
| Schlagworte: | Anti-C-X-C motif chemokine |
| Anwendung: | WB, ELISA |
| Wirt: | Chicken |
| Spezies-Reaktivität: | rabbit |
ab 274,00 €
Artikelnummer: SPOT2507U-004
Rabbit CXCL9 ELISpot contains Capture Antibody, Standard Control, and Detection Antibody for development of up to two (2) ELISpot assays. Other required materials and reagents are not supplied. The antibodies have been determined to function in an ELISpot with the Standard Control provided. Components may also be...
| Schlagworte: | C-X-C motif chemokine |
| Anwendung: | ELISpot |
| Spezies-Reaktivität: | rabbit |
1.646,00 €
Artikelnummer: CSB-PA006252ZA01RB.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-C-X-C motif chemokine, CXCL9 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Oryctolagus cuniculus (Rabbit) |
ab 1.529,00 €