Zu "Q9Z1R3" wurden 14 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Apolipoprotein M/APOM Protein, Mouse, Recombinant (His)
Apolipoprotein M/APOM Protein, Mouse, Recombinant (His)

Artikelnummer: TGM-TMPH-02518-10ug

Description: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid. APOM Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 23.3 kDa and...
Schlagworte: Ng20 , Apom , ApoM , Apo-M , Apolipoprotein M
MW: 23.3 kD
ab 99,00 €
Bewerten
Apolipoprotein M/APOM Protein, Mouse, Recombinant (E. coli, His)
Apolipoprotein M/APOM Protein, Mouse, Recombinant (E....

Artikelnummer: TGM-TMPH-04505-100ug

Description: Apolipoprotein M/APOM Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli. The accession number is Q9Z1R3.
Schlagworte: Apom , Apo-M,ApoM , Ng20 , Apolipoprotein M
MW: 27.2 kD
ab 93,00 €
Bewerten
Anti-Apolipoprotein M, Internal
Anti-Apolipoprotein M, Internal

Artikelnummer: ARG64714.100

Protein function: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid. [The UniProt Consortium]
Schlagworte: Anti-Apom, Anti-Ng20, Anti-ApoM, Anti-Apo-M, Anti-Apolipoprotein M
Anwendung: ELISA, WB
Wirt: Goat
Spezies-Reaktivität: human
871,00 €
Bewerten
Anti-Apom
Anti-Apom

Artikelnummer: NSJ-R34449-100UG

0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Apolipoprotein M Protein function: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and...
Schlagworte: Anti-Ng20, Anti-ApoM, Anti-Apom, Anti-Apo-M, Anti-Apolipoprotein M, Apom Antibody
Anwendung: WB, ELISA (peptide)
Wirt: Goat
Spezies-Reaktivität: human
836,00 €
Bewerten
Mouse ApoM (Apolipoprotein M) ELISA Kit
Mouse ApoM (Apolipoprotein M) ELISA Kit

Artikelnummer: G-MOES01281.96

ELISA Type: Sandwich. Sensitivity: 0.094ng/mL. Range: 0.156--10ng/mL. Protein function: Probably involved in lipid transport. Can bind sphingosine-1- phosphate, myristic acid, palmitic acid and stearic acid, retinol, all- trans-retinoic acid and 9-cis-retinoic acid. [The UniProt Consortium]
Schlagworte: Ng20, Apom, ApoM, Apo-M, Apolipoprotein M
Anwendung: Sandwich ELISA
Spezies-Reaktivität: mouse
708,00 €
Bewerten
Apolipoprotein M (Apom), mouse, recombinant
Apolipoprotein M (Apom), mouse, recombinant

Artikelnummer: CSB-EP001947MO.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 1-190aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MFHQVWAALL SLYGLLFNSM NQCPEHSQLT ALGMDDTETP EPHLGLWYFI AGAASTTEEL ATFDPVDNIV FNMAAGSAPR QLQLRATIRT KSGVCVPRKW TYRLTEGKGN MELRTEGRPD MKTDLFSSSC...
Schlagworte: ApoM, Ng20, Apom, Apo-M, Apolipoprotein M, Recombinant Mouse Apolipoprotein M (Apom)
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: mouse
MW: 27.2 kD
ab 247,00 €
Bewerten
Apolipoprotein M (Apom), mouse, recombinant
Apolipoprotein M (Apom), mouse, recombinant

Artikelnummer: CSB-YP001947MO.1

Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 1-190aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MFHQVWAALL SLYGLLFNSM NQCPEHSQLT ALGMDDTETP EPHLGLWYFI AGAASTTEEL ATFDPVDNIV FNMAAGSAPR QLQLRATIRT KSGVCVPRKW TYRLTEGKGN MELRTEGRPD MKTDLFSSSC PGGIMLKETG...
Schlagworte: ApoM, Ng20, Apom, Apo-M, Apolipoprotein M, Recombinant Mouse Apolipoprotein M (Apom)
Anwendung: Activity not tested
Exprimiert in: Yeast
Ursprungsart: mouse
MW: 23.3 kD
ab 292,00 €
Bewerten
APOM Protein, Mouse, Recombinant (His)
APOM Protein, Mouse, Recombinant (His)

Artikelnummer: TGM-TMPH-02518-100ug

Description: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid. APOM Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 23.3 kDa and...
Schlagworte: ApoM, Apo-M, Apolipoprotein M, Ng20
MW: 23.3 kD
ab 266,00 €
Bewerten
Mouse APOM (Apolipoprotein M) ELISA Kit
Mouse APOM (Apolipoprotein M) ELISA Kit

Artikelnummer: G-AEKE05418.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse APOM. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse APOM. Next,...
Schlagworte: Apom, Apolipoprotein M
Anwendung: ELISA
Spezies-Reaktivität: rat
694,00 €
Bewerten
Mouse Apolipoprotein M (APOM) ELISA kit
Mouse Apolipoprotein M (APOM) ELISA kit

Artikelnummer: CSB-EL001947MO.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 1.56 ng/mL-100 ng/mL Sensitivity: 0.39 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Probably involved in lipid transport. Can bind sphingosine-1-...
Schlagworte: Ng20, Apom, ApoM, Apo-M, Apolipoprotein M
Anwendung: ELISA, Sandwich ELISA
Spezies-Reaktivität: mouse
ab 581,00 €
Bewerten
Anti-Apolipoprotein M (ApoM, G3a, HSPC336, MGC22400, NG20, NG20-like protein)
Anti-Apolipoprotein M (ApoM, G3a, HSPC336, MGC22400,...

Artikelnummer: A2299-42F.100

Apolipoprotein M (ApoM) is a member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. It is positively related to leptin. It is mainly expressed in liver and kidney. ApoM is secreted through...
Schlagworte: Anti-Apo-M
Anwendung: ELISA, WB
Wirt: Goat
Spezies-Reaktivität: human
797,00 €
Bewerten
Apolipoprotein M (APOM) Recombinant, Mouse
Apolipoprotein M (APOM) Recombinant, Mouse

Artikelnummer: 153589.10

Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Z1R3, Fragment: Met20~Lys190 (Accession No: Q9Z1R3), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-M NQCPEHSQLT ALGMDDTETP EPHLGLWYFI AGAASTTEEL ATFDPVDNIV FNMAAGSAPR...
ab 454,00 €
Bewerten
1 von 2 Seiten