Zu "Q9Y3D3" wurden 17 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPS16
Anti-MRPS16

Artikelnummer: G-PACO23351.100

MRPS16 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, WB, IHC applications. MRPS16 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: ELISA, WB, IHC
Reaktivität: Human, Mouse
417,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: G-PACO45147.50

MRPS16 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, WB, IHC applications. MRPS16 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: ELISA, WB, IHC
Reaktivität: Human, Mouse
231,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: G-PACO45148.50

MRPS16 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB, IHC applications. MRPS16 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: ELISA, WB, IHC
Reaktivität: Human
231,00 €
Bewerten
NEU
Anti-MRPS16
Anti-MRPS16

Artikelnummer: ATA-HPA050081.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 88%
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB, IHC, ICC
Reaktivität: Human
ab 156,00 €
Bewerten
NEU
Anti-MRPS16
Anti-MRPS16

Artikelnummer: ATA-HPA054538.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 95%
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB, IHC
Reaktivität: Human
ab 156,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: E-AB-62435.120

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB
Reaktivität: Human, Mouse, Rat
ab 117,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: G-CAB9874.100

Anwendung: WB
Reaktivität: Human, Mouse, Rat
314,00 €
Bewerten
NEU
MRPS16, Recombinant, Human, aa1-137, GST-Tag (28S Ribosomal Protein S16, Mitochondrial)
MRPS16, Recombinant, Human, aa1-137, GST-Tag (28S...

Artikelnummer: 374275.100

Source:, Recombinant protein corresponding to aa1-137 from human MRPS16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.5kD, AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET, Storage and Stability: May be stored at 4°C...
Schlagworte: S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit...
MW: 38,5
ab 455,00 €
Bewerten
Anti-MRPS16 (PACO04516)
Anti-MRPS16 (PACO04516)

Artikelnummer: G-PACO04516.50

MRPS16 Antibody (PACO04516)
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: ELISA, WB, IHC
Reaktivität: Human, Mouse
231,00 €
Bewerten
Anti-MRPS16 Polyclonal (CAB9874)
Anti-MRPS16 Polyclonal (CAB9874)

Artikelnummer: G-CAB9874.20

MRPS16 Polyclonal Antibody (CAB9874) from Antibody Genie, is tested in WB applications.The MRPS16 Polyclonal Antibody (CAB9874) is reactive versus Human, Mouse, Rat samples.
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB
Reaktivität: Human, Mouse, Rat
ab 104,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: G-PACO10600.50

MRPS16 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB applications. MRPS16 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: ELISA, WB
Reaktivität: Human, Mouse, Rat
406,00 €
Bewerten
NEU
MRPS16 PrEST Antigen
MRPS16 PrEST Antigen

Artikelnummer: ATA-APrEST84675.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: S16mt, RPMS16, MRPS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit...
Anwendung: Control antigen
Reaktivität: Human
186,00 €
Bewerten
1 von 2 Seiten